![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
![]() | Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (4 PDB entries) |
![]() | Domain d2z31d2: 2z31 D:4-93 [153954] Other proteins in same PDB: d2z31a_, d2z31b_, d2z31c1, d2z31c2, d2z31d1 automatically matched to d1f3jb2 |
PDB Entry: 2z31 (more details), 2.7 Å
SCOPe Domain Sequences for d2z31d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z31d2 d.19.1.1 (D:4-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]} erhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyynk qylertraeldtvcrynyeetevptslrr
Timeline for d2z31d2:
![]() Domains from other chains: (mouse over for more information) d2z31a_, d2z31b_, d2z31c1, d2z31c2 |