Lineage for d2z31d2 (2z31 D:4-93)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856861Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 856935Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (5 PDB entries)
  8. 856940Domain d2z31d2: 2z31 D:4-93 [153954]
    Other proteins in same PDB: d2z31c1, d2z31c2, d2z31d1
    automatically matched to d1f3jb2

Details for d2z31d2

PDB Entry: 2z31 (more details), 2.7 Å

PDB Description: Crystal structure of immune receptor complex
PDB Compounds: (D:) H-2 class II histocompatibility antigen, A-U beta chain precursor

SCOP Domain Sequences for d2z31d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z31d2 d.19.1.1 (D:4-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
erhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyynk
qylertraeldtvcrynyeetevptslrr

SCOP Domain Coordinates for d2z31d2:

Click to download the PDB-style file with coordinates for d2z31d2.
(The format of our PDB-style files is described here.)

Timeline for d2z31d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z31d1