Lineage for d2z31d1 (2z31 D:94-190)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292026Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1292099Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (16 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1292113Domain d2z31d1: 2z31 D:94-190 [153953]
    Other proteins in same PDB: d2z31a_, d2z31b_, d2z31c1, d2z31c2, d2z31d2
    automatically matched to d1f3jb1

Details for d2z31d1

PDB Entry: 2z31 (more details), 2.7 Å

PDB Description: Crystal structure of immune receptor complex
PDB Compounds: (D:) H-2 class II histocompatibility antigen, A-U beta chain precursor

SCOPe Domain Sequences for d2z31d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z31d1 b.1.1.2 (D:94-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
leqpnvvislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtprrgevytchvehpslkspitvewra

SCOPe Domain Coordinates for d2z31d1:

Click to download the PDB-style file with coordinates for d2z31d1.
(The format of our PDB-style files is described here.)

Timeline for d2z31d1: