Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries) |
Domain d2z31c2: 2z31 C:4-81 [153952] Other proteins in same PDB: d2z31a_, d2z31b_, d2z31c1, d2z31c3, d2z31d1, d2z31d2 automatically matched to d1k2da2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2z31 (more details), 2.7 Å
SCOPe Domain Sequences for d2z31c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z31c2 d.19.1.1 (C:4-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} dhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgglqn iatgkhnlgvltkrsnstp
Timeline for d2z31c2:
View in 3D Domains from other chains: (mouse over for more information) d2z31a_, d2z31b_, d2z31d1, d2z31d2 |