SCOPe 2.02: Domain d2z31c1: 2z31 C:82-180

Lineage for d2z31c1 (2z31 C:82-180)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d2z31c1: 2z31 C:82-180 [153951]
   Other proteins in same PDB: d2z31a_, d2z31b_, d2z31c2, d2z31d1, d2z31d2
   automatically matched to d1k2da1

Details for d2z31c1

PDB Entry: 2z31, 2.7 Å

PDB Description: Crystal structure of immune receptor complex

PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOPe Domain Sequences for d2z31c1:

Sequence; same for both SEQRES and ATOM records:

>d2z31c1 b.1.1.2 (C:82-180) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwep

Timeline for d2z31c1:

• d2z31c1 first appeared in SCOP 1.75
  
• d2z31c1 appears in SCOPe 2.01
  
• d2z31c1 appears in SCOPe 2.03
  
• d2z31c1 appears in the current release, SCOPe 2.08