![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
![]() | Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (32 PDB entries) probably orthologous to the human HLA-DQ group |
![]() | Domain d2z31c1: 2z31 C:82-180 [153951] Other proteins in same PDB: d2z31a_, d2z31b_, d2z31c2, d2z31c3, d2z31d1, d2z31d2 automatically matched to d1k2da1 |
PDB Entry: 2z31 (more details), 2.7 Å
SCOPe Domain Sequences for d2z31c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z31c1 b.1.1.2 (C:82-180) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr dysfhklsyltfipsdddiydckvehwgleepvlkhwep
Timeline for d2z31c1:
![]() Domains from other chains: (mouse over for more information) d2z31a_, d2z31b_, d2z31d1, d2z31d2 |