SCOPe 2.01: Domain d1c40a_: 1c40 A:

Lineage for d1c40a_ (1c40 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (22 species)

7. Species Bar-headed goose (Anser indicus) [TaxId:8846] [46493] (3 PDB entries)

8. Domain d1c40a_: 1c40 A: [15395]
   Other proteins in same PDB: d1c40b_
   complexed with hem

Details for d1c40a_

PDB Entry: 1c40, 2.3 Å

PDB Description: bar-headed goose hemoglobin (aquomet form)

PDB Compounds: (A:) protein (hemoglobin (alpha chain))

SCOPe Domain Sequences for d1c40a_:

Sequence; same for both SEQRES and ATOM records:

>d1c40a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvvaalveavnhiddiagalsklsnlhaqklrvdpvnfkflghcflvvvaihhpsaltae
vhasldkflcavgtvltakyr

Timeline for d1c40a_:

• d1c40a_ first appeared (with stable ids) in SCOP 1.55
  
• d1c40a_ appears in SCOP 1.75
  
• d1c40a_ appears in SCOPe 2.02
  
• d1c40a_ appears in the current release, SCOPe 2.08