Lineage for d2z2lf1 (2z2l F:631-692)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1400983Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 1400984Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) (S)
    duplication: consists of 2 subdomains of this fold
  5. 1400985Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 1400986Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 1400987Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)
  8. 1401008Domain d2z2lf1: 2z2l F:631-692 [153941]
    Other proteins in same PDB: d2z2lb1, d2z2le1
    automatically matched to d1pmda1
    complexed with so4

Details for d2z2lf1

PDB Entry: 2z2l (more details), 2.85 Å

PDB Description: penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae
PDB Compounds: (F:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2z2lf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z2lf1 d.11.1.1 (F:631-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
sqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlils
dk

SCOPe Domain Coordinates for d2z2lf1:

Click to download the PDB-style file with coordinates for d2z2lf1.
(The format of our PDB-style files is described here.)

Timeline for d2z2lf1: