Lineage for d2z2le_ (2z2l E:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013522Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)
  7. 3013523Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries)
  8. 3013536Domain d2z2le_: 2z2l E: [153940]
    Other proteins in same PDB: d2z2lc1, d2z2lc2, d2z2lf1, d2z2lf2
    automated match to d2zc3b1
    complexed with so4

Details for d2z2le_

PDB Entry: 2z2l (more details), 2.85 Å

PDB Description: penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae
PDB Compounds: (E:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2z2le_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z2le_ e.3.1.1 (E:) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rtmdgkdvyttissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdad
tkegitedfvwrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatird
wdvnegltggrmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdey
agqlpadnivniaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtark
sqkeivgnpvskdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqi
adeknggylvgltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasa
mkdslnl

SCOPe Domain Coordinates for d2z2le_:

Click to download the PDB-style file with coordinates for d2z2le_.
(The format of our PDB-style files is described here.)

Timeline for d2z2le_: