SCOPe 2.05: Domain d1a4fa_: 1a4f A:

Lineage for d1a4fa_ (1a4f A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Bar-headed goose (Anser indicus) [TaxId:8846] [46493] (3 PDB entries)

8. Domain d1a4fa_: 1a4f A: [15394]
   Other proteins in same PDB: d1a4fb_
   complexed with hem, oxy

Details for d1a4fa_

PDB Entry: 1a4f, 2 Å

PDB Description: bar-headed goose hemoglobin (oxy form)

PDB Compounds: (A:) hemoglobin (alpha chain)

SCOPe Domain Sequences for d1a4fa_:

Sequence; same for both SEQRES and ATOM records:

>d1a4fa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus) [TaxId: 8846]}
vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvvaalveavnhiddiagalsklsdlhaqklrvdpvnfkflghcflvvvaihhpsaltae
vhasldkflcavgtvltakyr

Timeline for d1a4fa_:

• d1a4fa_ first appeared (with stable ids) in SCOP 1.55
  
• d1a4fa_ appears in SCOPe 2.04
  
• d1a4fa_ appears in SCOPe 2.06
  
• d1a4fa_ appears in the current release, SCOPe 2.08