Lineage for d2z2lb1 (2z2l B:264-620)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883343Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (18 proteins)
  6. 883741Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)
  7. 883742Species Streptococcus pneumoniae [TaxId:1313] [56625] (10 PDB entries)
  8. 883752Domain d2z2lb1: 2z2l B:264-620 [153937]
    Other proteins in same PDB: d2z2lc1, d2z2lc2, d2z2lf1, d2z2lf2
    automatically matched to d1pmda4
    complexed with so4

Details for d2z2lb1

PDB Entry: 2z2l (more details), 2.85 Å

PDB Description: penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae
PDB Compounds: (B:) penicillin-binding protein 2x

SCOP Domain Sequences for d2z2lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z2lb1 e.3.1.1 (B:264-620) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnl

SCOP Domain Coordinates for d2z2lb1:

Click to download the PDB-style file with coordinates for d2z2lb1.
(The format of our PDB-style files is described here.)

Timeline for d2z2lb1: