SCOPe 2.08: Domain d2z2lb_: 2z2l B:

Lineage for d2z2lb_ (2z2l B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries)

8. Domain d2z2lb_: 2z2l B: [153937]
   Other proteins in same PDB: d2z2lc1, d2z2lc2, d2z2lf1, d2z2lf2
   automated match to d2zc3b1
   complexed with so4

Details for d2z2lb_

PDB Entry: 2z2l, 2.85 Å

PDB Description: penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae

PDB Compounds: (B:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2z2lb_:

Sequence; same for both SEQRES and ATOM records:

>d2z2lb_ e.3.1.1 (B:) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rtmdgkdvyttissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdad
tkegitedfvwrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatird
wdvnegltggrmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdey
agqlpadnivniaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtark
sqkeivgnpvskdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqi
adeknggylvgltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasa
mkdslnl

Timeline for d2z2lb_:

• d2z2lb_ first appeared in SCOP 1.75, called d2z2lb1
  
• d2z2lb_ appears in SCOPe 2.07