SCOP 1.75: Domain d2z2da1: 2z2d A:106-263

Lineage for d2z2da1 (2z2d A:106-263)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (18 PDB entries)
   Uniprot P39900 106-263
   Uniprot P39900 106-264
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d2z2da1: 2z2d A:106-263 [153936]
   automatically matched to d1jiza_
   complexed with ca, hsi, zn

Details for d2z2da1

PDB Entry: 2z2d

PDB Description: solution structure of human macrophage elastase (mmp-12) catalytic domain complexed with a gamma-keto butanoic acid inhibitor

PDB Compounds: (A:) Macrophage metalloelastase

SCOP Domain Sequences for d2z2da1:

Sequence; same for both SEQRES and ATOM records:

>d2z2da1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d2z2da1:

• d2z2da1 is new in SCOP 1.75
  
• d2z2da1 appears in SCOPe 2.01
  
• d2z2da1 appears in the current release, SCOPe 2.08, called d2z2da_