SCOPe 2.08: Domain d2z2da_: 2z2d A:

Lineage for d2z2da_ (2z2d A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d2z2da_: 2z2d A: [153936]
   automated match to d2k2ga_
   complexed with ca, hsi, zn

Details for d2z2da_

PDB Entry: 2z2d

PDB Description: solution structure of human macrophage elastase (mmp-12) catalytic domain complexed with a gamma-keto butanoic acid inhibitor

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d2z2da_:

Sequence; same for both SEQRES and ATOM records:

>d2z2da_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d2z2da_:

• d2z2da_ first appeared in SCOP 1.75, called d2z2da1
  
• d2z2da_ appears in SCOPe 2.07