Lineage for d2z1ea2 (2z1e A:156-334)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873568Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 873569Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) (S)
  5. 873570Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 873581Protein Hydrogenase expression/formation protein HypE [160783] (1 species)
  7. 873582Species Thermococcus kodakaraensis [TaxId:311400] [160784] (2 PDB entries)
    Uniprot Q5JII7 156-334
  8. 873583Domain d2z1ea2: 2z1e A:156-334 [153933]
    Other proteins in same PDB: d2z1ea1

Details for d2z1ea2

PDB Entry: 2z1e (more details), 1.55 Å

PDB Description: Crystal structure of HypE from Thermococcus kodakaraensis (outward form)
PDB Compounds: (A:) Hydrogenase expression/formation protein HypE

SCOP Domain Sequences for d2z1ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z1ea2 d.139.1.1 (A:156-334) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]}
vsdagakvgdavlvsgtigdhgialmshregiafetelksdvapiwdvvkavaetigwen
ihamkdptraglsnalneiarksnvgilvreadipirpevraasemlgispydvanegkv
vmvvareyaeealeamrktekgrnaaiigeviadyrgkvlletgiggkrfmeppegdpv

SCOP Domain Coordinates for d2z1ea2:

Click to download the PDB-style file with coordinates for d2z1ea2.
(The format of our PDB-style files is described here.)

Timeline for d2z1ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z1ea1