Lineage for d2z1ea1 (2z1e A:43-155)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566869Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2566870Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 2566901Protein Hydrogenase expression/formation protein HypE [160513] (1 species)
  7. 2566902Species Thermococcus kodakaraensis [TaxId:311400] [160514] (3 PDB entries)
    Uniprot Q5JII7 41-155
  8. 2566903Domain d2z1ea1: 2z1e A:43-155 [153932]
    Other proteins in same PDB: d2z1ea2

Details for d2z1ea1

PDB Entry: 2z1e (more details), 1.55 Å

PDB Description: Crystal structure of HypE from Thermococcus kodakaraensis (outward form)
PDB Compounds: (A:) Hydrogenase expression/formation protein HypE

SCOPe Domain Sequences for d2z1ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z1ea1 d.79.4.1 (A:43-155) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]}
dgatipfgdkhivftidghtvkplffpggdigrlavsgtvndlavmgaepialansmiig
egldmevlkrvlksmdetarevpvpivtgdtkvvedkiemfvitagigiaehp

SCOPe Domain Coordinates for d2z1ea1:

Click to download the PDB-style file with coordinates for d2z1ea1.
(The format of our PDB-style files is described here.)

Timeline for d2z1ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z1ea2