| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
| Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
| Protein Hydrogenase expression/formation protein HypE [160513] (1 species) |
| Species Thermococcus kodakaraensis [TaxId:311400] [160514] (3 PDB entries) Uniprot Q5JII7 41-155 |
| Domain d2z1ea1: 2z1e A:43-155 [153932] Other proteins in same PDB: d2z1ea2 |
PDB Entry: 2z1e (more details), 1.55 Å
SCOPe Domain Sequences for d2z1ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z1ea1 d.79.4.1 (A:43-155) Hydrogenase expression/formation protein HypE {Thermococcus kodakaraensis [TaxId: 311400]}
dgatipfgdkhivftidghtvkplffpggdigrlavsgtvndlavmgaepialansmiig
egldmevlkrvlksmdetarevpvpivtgdtkvvedkiemfvitagigiaehp
Timeline for d2z1ea1: