![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.14: HupF/HypC-like [159127] (1 family) ![]() contains extra C-terminal helix packed against the beta-barrel side automatically mapped to Pfam PF01455 |
![]() | Family b.40.14.1: HupF/HypC-like [159128] (1 protein) Pfam PF01455 |
![]() | Protein Hydrogenase expression/formation protein HypC [159129] (3 species) |
![]() | Species Thermococcus kodakaraensis [TaxId:311400] [159132] (5 PDB entries) Uniprot Q5JII0 2-72 |
![]() | Domain d2z1cc_: 2z1c C: [153931] automated match to d2z1ca1 complexed with gol, pg4 |
PDB Entry: 2z1c (more details), 1.8 Å
SCOPe Domain Sequences for d2z1cc_:
Sequence, based on SEQRES records: (download)
>d2z1cc_ b.40.14.1 (C:) Hydrogenase expression/formation protein HypC {Thermococcus kodakaraensis [TaxId: 311400]} lavpgkvievngpvavvdfggvkrevrldlmpdtkpgdwvivhtgfaiekldekkameil eawaevekamegf
>d2z1cc_ b.40.14.1 (C:) Hydrogenase expression/formation protein HypC {Thermococcus kodakaraensis [TaxId: 311400]} lavpgkvievngpvavvdfggvkrevrldlmpdtkgdwvivhtgfaieldekkameilea waevekamegf
Timeline for d2z1cc_: