Lineage for d2z15d2 (2z15 D:10-125)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011694Fold d.370: BTG domain-like [160695] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); four-helical bundle, capped at one end by an antiparallel beta-sheet, order:1234
  4. 3011695Superfamily d.370.1: BTG domain-like [160696] (1 family) (S)
    automatically mapped to Pfam PF07742
  5. 3011696Family d.370.1.1: BTG domain-like [160697] (3 proteins)
    Pfam PF07742
  6. 3011700Protein TOB1, N-terminal domain [160698] (1 species)
  7. 3011701Species Human (Homo sapiens) [TaxId:9606] [160699] (4 PDB entries)
    Uniprot P50616 1-115! Uniprot P50616 1-117
  8. 3011705Domain d2z15d2: 2z15 D:10-125 [153924]
    Other proteins in same PDB: d2z15a2, d2z15b3, d2z15c3, d2z15d3
    automated match to d2z15a1

Details for d2z15d2

PDB Entry: 2z15 (more details), 2.3 Å

PDB Description: Crystal structure of human Tob1 protein
PDB Compounds: (D:) Protein Tob1

SCOPe Domain Sequences for d2z15d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z15d2 d.370.1.1 (D:10-125) TOB1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mqleiqvalnfiisylynklprrrvnifgeelerllkkkyeghwypekpykgsgfrcihi
gekvdpvieqaskesgldiddvrgnlpqdlsvwidpfevsyqigekgpvkvlyvdd

SCOPe Domain Coordinates for d2z15d2:

Click to download the PDB-style file with coordinates for d2z15d2.
(The format of our PDB-style files is described here.)

Timeline for d2z15d2: