SCOPe 2.08: Domain d2z15c2: 2z15 C:10-125

Lineage for d2z15c2 (2z15 C:10-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.370: BTG domain-like [160695] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); four-helical bundle, capped at one end by an antiparallel beta-sheet, order:1234

4. Superfamily d.370.1: BTG domain-like [160696] (1 family)
   automatically mapped to Pfam PF07742

5. Family d.370.1.1: BTG domain-like [160697] (3 proteins)
   Pfam PF07742

6. Protein TOB1, N-terminal domain [160698] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160699] (4 PDB entries)
   Uniprot P50616 1-115! Uniprot P50616 1-117

8. Domain d2z15c2: 2z15 C:10-125 [153923]
   Other proteins in same PDB: d2z15a2, d2z15b3, d2z15c3, d2z15d3
   automated match to d2z15a1

Details for d2z15c2

PDB Entry: 2z15, 2.3 Å

PDB Description: Crystal structure of human Tob1 protein

PDB Compounds: (C:) Protein Tob1

SCOPe Domain Sequences for d2z15c2:

Sequence; same for both SEQRES and ATOM records:

>d2z15c2 d.370.1.1 (C:10-125) TOB1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mqleiqvalnfiisylynklprrrvnifgeelerllkkkyeghwypekpykgsgfrcihi
gekvdpvieqaskesgldiddvrgnlpqdlsvwidpfevsyqigekgpvkvlyvdd

Timeline for d2z15c2:

• d2z15c2 first appeared in SCOP 1.75, called d2z15c1
  
• d2z15c2 appears in SCOPe 2.07