![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [46492] (1 PDB entry) |
![]() | Domain d1hbra_: 1hbr A: [15392] Other proteins in same PDB: d1hbrb_, d1hbrd_ complexed with hem |
PDB Entry: 1hbr (more details), 2.3 Å
SCOPe Domain Sequences for d1hbra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbra_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Chicken (Gallus gallus) [TaxId: 9031]} mltaedkkliqqawekaashqeefgaealtrmfttypqtktyfphfdlspgsdqvrghgk kvlgalgnavknvdnlsqamaelsnlhaynlrvdpvnfkllsqciqvvlavhmgkdytpe vhaafdkflsavsavlaekyr
Timeline for d1hbra_: