SCOP 1.75: Domain d2z0ya2: 2z0y A:67-228

Lineage for d2z0ya2 (2z0y A:67-228)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (8 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.5: YggJ C-terminal domain-like [89632] (3 proteins)
   contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain

6. Protein Hypothetical protein TTHA0657 (TT1575) [117494] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117495] (3 PDB entries)
   Uniprot Q5SKI6

8. Domain d2z0ya2: 2z0y A:67-228 [153919]
   Other proteins in same PDB: d2z0ya1
   automatically matched to d1v6za2
   complexed with sam

Details for d2z0ya2

PDB Entry: 2z0y, 2.8 Å

PDB Description: Crystal structure of TTHA0657-SAM complex

PDB Compounds: (A:) Putative uncharacterized protein TTHA0657

SCOP Domain Sequences for d2z0ya2:

Sequence; same for both SEQRES and ATOM records:

>d2z0ya2 c.116.1.5 (A:67-228) Hypothetical protein TTHA0657 (TT1575) {Thermus thermophilus [TaxId: 274]}
revgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlraval
eaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeggf
aeeevalleargftpvslgrrilraetaalallalctagegr

Timeline for d2z0ya2:

• d2z0ya2 is new in SCOP 1.75
  
• d2z0ya2 appears in SCOPe 2.01
  
• d2z0ya2 appears in the current release, SCOPe 2.08