SCOPe 2.01: Domain d2z0sa1: 2z0s A:60-147

Lineage for d2z0sa1 (2z0s A:60-147)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein S1-domain of exosome complex RNA-binding protein 1, ECR1 [159100] (3 species)

7. Species Aeropyrum pernix [TaxId:56636] [159101] (1 PDB entry)
   Uniprot Q9YC02 60-147

8. Domain d2z0sa1: 2z0s A:60-147 [153916]
   Other proteins in same PDB: d2z0sa2
   protein/RNA complex

Details for d2z0sa1

PDB Entry: 2z0s, 3.2 Å

PDB Description: Crystal structure of putative exosome complex RNA-binding protein

PDB Compounds: (A:) Probable exosome complex RNA-binding protein 1

SCOPe Domain Sequences for d2z0sa1:

Sequence; same for both SEQRES and ATOM records:

>d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]}
eiyvpqagdvvigliqsvgimnwfvdinspyvavlsvqdflgrpfnpavddmqsllkvgd
yikakvvafdktrsplltvqgeglgriv

Timeline for d2z0sa1:

• d2z0sa1 first appeared in SCOP 1.75
  
• d2z0sa1 appears in SCOPe 2.02
  
• d2z0sa1 appears in the current release, SCOPe 2.08