Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein S1-domain of exosome complex RNA-binding protein 1, ECR1 [159100] (3 species) |
Species Aeropyrum pernix [TaxId:56636] [159101] (1 PDB entry) Uniprot Q9YC02 60-147 |
Domain d2z0sa1: 2z0s A:60-147 [153916] Other proteins in same PDB: d2z0sa2 protein/RNA complex |
PDB Entry: 2z0s (more details), 3.2 Å
SCOPe Domain Sequences for d2z0sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} eiyvpqagdvvigliqsvgimnwfvdinspyvavlsvqdflgrpfnpavddmqsllkvgd yikakvvafdktrsplltvqgeglgriv
Timeline for d2z0sa1: