SCOP 1.75: Domain d2z08a1: 2z08 A:2-136

Lineage for d2z08a1 (2z08 A:2-136)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (7 proteins)
   Pfam PF00582

6. Protein Hypothetical protein TTHA0895 [117487] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117488] (4 PDB entries)
   Uniprot Q5SJV7

8. Domain d2z08a1: 2z08 A:2-136 [153910]
   automatically matched to d1wjga_
   complexed with atp, mg

Details for d2z08a1

PDB Entry: 2z08, 1.55 Å

PDB Description: crystal structure of uncharacterized conserved protein from thermus thermophilus hb8

PDB Compounds: (A:) Universal stress protein family

SCOP Domain Sequences for d2z08a1:

Sequence, based on SEQRES records:

>d2z08a1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]}
fktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrler
aegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsq
sqrvvaeapcpvllv

Sequence, based on observed residues (ATOM records):

>d2z08a1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]}
fktillaydgseharraaevakaeaeahgarlivvhayeprrrleraegvleearaltgv
pkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpvll
v

Timeline for d2z08a1:

• d2z08a1 is new in SCOP 1.75
  
• d2z08a1 is called d2z08a_ in SCOPe 2.01
  
• d2z08a1 appears in the current release, SCOPe 2.08, called d2z08a_