| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.4: Universal stress protein-like [52436] (8 proteins) Pfam PF00582 |
| Protein automated matches [190391] (3 species) not a true protein |
| Species Thermus thermophilus [TaxId:274] [187253] (2 PDB entries) |
| Domain d2z08a_: 2z08 A: [153910] automated match to d1wjga_ complexed with atp, mg |
PDB Entry: 2z08 (more details), 1.55 Å
SCOPe Domain Sequences for d2z08a_:
Sequence, based on SEQRES records: (download)
>d2z08a_ c.26.2.4 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrle
raegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgs
qsqrvvaeapcpvllvr
>d2z08a_ c.26.2.4 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mfktillaydgseharraaevakaeaeahgarlivvhayeprrrleraegvleearaltg
vpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpvl
lvr
Timeline for d2z08a_: