![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [46491] (3 PDB entries) |
![]() | Domain d1qpwc_: 1qpw C: [15391] Other proteins in same PDB: d1qpwb_, d1qpwd_ complexed with hem, oxy |
PDB Entry: 1qpw (more details), 1.8 Å
SCOPe Domain Sequences for d1qpwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpwc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Pig (Sus scrofa) [TaxId: 9823]} vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps vhasldkflanvstvltskyr
Timeline for d1qpwc_: