Lineage for d1qpwc_ (1qpw C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299707Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2300449Species Pig (Sus scrofa) [TaxId:9823] [46491] (3 PDB entries)
  8. 2300451Domain d1qpwc_: 1qpw C: [15391]
    Other proteins in same PDB: d1qpwb_, d1qpwd_
    complexed with hem, oxy

Details for d1qpwc_

PDB Entry: 1qpw (more details), 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution
PDB Compounds: (C:) porcine hemoglobin (alpha subunit)

SCOPe Domain Sequences for d1qpwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpwc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Pig (Sus scrofa) [TaxId: 9823]}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d1qpwc_:

Click to download the PDB-style file with coordinates for d1qpwc_.
(The format of our PDB-style files is described here.)

Timeline for d1qpwc_: