SCOP 1.73: Domain d1qpwc_: 1qpw C:

Lineage for d1qpwc_ (1qpw C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (19 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [46491] (2 PDB entries)

8. Domain d1qpwc_: 1qpw C: [15391]
   Other proteins in same PDB: d1qpwb_, d1qpwd_
   complexed with hem, o2

Details for d1qpwc_

PDB Entry: 1qpw, 1.8 Å

PDB Description: crystal structure determination of porcine hemoglobin at 1.8a resolution

PDB Compounds: (C:) poricine hemoglobin (alpha subunit)

SCOP Domain Sequences for d1qpwc_:

Sequence; same for both SEQRES and ATOM records:

>d1qpwc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Pig (Sus scrofa) [TaxId: 9823]}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

Timeline for d1qpwc_:

• d1qpwc_ first appeared (with stable ids) in SCOP 1.55
  
• d1qpwc_ appears in SCOP 1.71
  
• d1qpwc_ appears in SCOP 1.75
  
• d1qpwc_ appears in the current release, SCOPe 2.08