Lineage for d2z06c_ (2z06 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998424Family d.159.1.10: TTHA0625-like [143938] (1 protein)
    part of Pfam PF00149
  6. 2998425Protein Hypothetical protein TTHA0625 [143939] (1 species)
  7. 2998426Species Thermus thermophilus [TaxId:274] [143940] (2 PDB entries)
    Uniprot Q5SKL8 1-252
  8. 2998429Domain d2z06c_: 2z06 C: [153908]
    automated match to d2cv9a1
    complexed with co

Details for d2z06c_

PDB Entry: 2z06 (more details), 2.2 Å

PDB Description: Crystal structure of uncharacterized conserved protein from Thermus thermophilus
PDB Compounds: (C:) Putative uncharacterized protein TTHA0625

SCOPe Domain Sequences for d2z06c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z06c_ d.159.1.10 (C:) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]}
mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl
vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp
lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr
lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr
pvaispyvweep

SCOPe Domain Coordinates for d2z06c_:

Click to download the PDB-style file with coordinates for d2z06c_.
(The format of our PDB-style files is described here.)

Timeline for d2z06c_: