SCOPe 2.01: Domain d2z06b_: 2z06 B:

Lineage for d2z06b_ (2z06 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.10: TTHA0625-like [143938] (1 protein)
   part of Pfam PF00149

6. Protein Hypothetical protein TTHA0625 [143939] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143940] (2 PDB entries)
   Uniprot Q5SKL8 1-252

8. Domain d2z06b_: 2z06 B: [153907]
   automated match to d2cv9a1
   complexed with co

Details for d2z06b_

PDB Entry: 2z06, 2.2 Å

PDB Description: Crystal structure of uncharacterized conserved protein from Thermus thermophilus

PDB Compounds: (B:) Putative uncharacterized protein TTHA0625

SCOPe Domain Sequences for d2z06b_:

Sequence; same for both SEQRES and ATOM records:

>d2z06b_ d.159.1.10 (B:) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]}
mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl
vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp
lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr
lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr
pvaispyvweep

Timeline for d2z06b_:

• d2z06b_ first appeared in SCOP 1.75, called d2z06b1
  
• d2z06b_ appears in SCOPe 2.02
  
• d2z06b_ appears in the current release, SCOPe 2.08