Lineage for d2z06a_ (2z06 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604352Family d.159.1.10: TTHA0625-like [143938] (1 protein)
    part of Pfam PF00149
  6. 2604353Protein Hypothetical protein TTHA0625 [143939] (1 species)
  7. 2604354Species Thermus thermophilus [TaxId:274] [143940] (2 PDB entries)
    Uniprot Q5SKL8 1-252
  8. 2604355Domain d2z06a_: 2z06 A: [153906]
    automated match to d2cv9a1
    complexed with co

Details for d2z06a_

PDB Entry: 2z06 (more details), 2.2 Å

PDB Description: Crystal structure of uncharacterized conserved protein from Thermus thermophilus
PDB Compounds: (A:) Putative uncharacterized protein TTHA0625

SCOPe Domain Sequences for d2z06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z06a_ d.159.1.10 (A:) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]}
mrvlfigdvmaepglravglhlpdirdrydlviangenaargkgldrrsyrllreagvdl
vslgnhawdhkevyallesepvvrplnyppgtpgkgfwrlevggesllfvqvmgrifmdp
lddpfraldrlleeekadyvlvevhaeatsekmalahyldgrasavlgththvptldatr
lpkgtlyqtdvgmtgtyhsiiggevetflarfltgrpqpfraaqgkarfhatelvfeggr
pvaispyvweep

SCOPe Domain Coordinates for d2z06a_:

Click to download the PDB-style file with coordinates for d2z06a_.
(The format of our PDB-style files is described here.)

Timeline for d2z06a_: