Lineage for d2yzee2 (2yze E:142-297)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1662613Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1662614Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1662861Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 1663066Protein automated matches [254656] (2 species)
    not a true protein
  7. 1663067Species Arthrobacter globiformis [TaxId:1665] [255720] (4 PDB entries)
  8. 1663109Domain d2yzee2: 2yze E:142-297 [153895]
    automated match to d2yzea2
    complexed with nob

Details for d2yzee2

PDB Entry: 2yze (more details), 1.99 Å

PDB Description: Crystal structure of uricase from Arthrobacter globiformis
PDB Compounds: (E:) Uricase

SCOPe Domain Sequences for d2yzee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzee2 d.96.1.4 (E:142-297) automated matches {Arthrobacter globiformis [TaxId: 1665]}
seqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarwryntvevdfda
vyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnkhhflvdlqpfg
qdnpnevfyaadrpyglieatiqregsradhpiwsn

SCOPe Domain Coordinates for d2yzee2:

Click to download the PDB-style file with coordinates for d2yzee2.
(The format of our PDB-style files is described here.)

Timeline for d2yzee2: