| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins) automatically mapped to Pfam PF01014 |
| Protein automated matches [254656] (2 species) not a true protein |
| Species Arthrobacter globiformis [TaxId:1665] [255720] (4 PDB entries) |
| Domain d2yzee1: 2yze E:11-141 [153894] automated match to d2yzea1 complexed with nob |
PDB Entry: 2yze (more details), 1.99 Å
SCOPe Domain Sequences for d2yzee1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yzee1 d.96.1.4 (E:11-141) automated matches {Arthrobacter globiformis [TaxId: 1665]}
tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
evrtavleisg
Timeline for d2yzee1: