Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein) |
Protein Urate oxidase (uricase) [55634] (3 species) duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16 |
Species Arthrobacter globiformis [TaxId:1665] [143630] (6 PDB entries) |
Domain d2yzed2: 2yze D:142-297 [153893] automatically matched to d1vaxa1 complexed with nob |
PDB Entry: 2yze (more details), 1.99 Å
SCOP Domain Sequences for d2yzed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yzed2 d.96.1.4 (D:142-297) Urate oxidase (uricase) {Arthrobacter globiformis [TaxId: 1665]} seqaivagiegltvlkstgsefhgfprdkyttlqettdrilatdvsarwryntvevdfda vyasvrglllkafaethslalqqtmyemgraviethpeideikmslpnkhhflvdlqpfg qdnpnevfyaadrpyglieatiqregsradhpiwsn
Timeline for d2yzed2: