SCOPe 2.08: Domain d2yzed1: 2yze D:11-141

Lineage for d2yzed1 (2yze D:11-141)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein automated matches [254656] (4 species)
   not a true protein

7. Species Arthrobacter globiformis [TaxId:1665] [255720] (5 PDB entries)

8. Domain d2yzed1: 2yze D:11-141 [153892]
   automated match to d2yzec1
   complexed with nob

Details for d2yzed1

PDB Entry: 2yze, 1.99 Å

PDB Description: Crystal structure of uricase from Arthrobacter globiformis

PDB Compounds: (D:) Uricase

SCOPe Domain Sequences for d2yzed1:

Sequence; same for both SEQRES and ATOM records:

>d2yzed1 d.96.1.4 (D:11-141) automated matches {Arthrobacter globiformis [TaxId: 1665]}
tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
evrtavleisg

Timeline for d2yzed1:

• d2yzed1 first appeared in SCOP 1.75
  
• d2yzed1 appears in SCOPe 2.07