Lineage for d2pghc_ (2pgh C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473405Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1473986Species Pig (Sus scrofa) [TaxId:9823] [46491] (3 PDB entries)
  8. 1473990Domain d2pghc_: 2pgh C: [15389]
    Other proteins in same PDB: d2pghb_, d2pghd_
    complexed with hem

Details for d2pghc_

PDB Entry: 2pgh (more details), 2.8 Å

PDB Description: structure determination of aquomet porcine hemoglobin at 2.8 angstrom resolution
PDB Compounds: (C:) hemoglobin (aquo met) (alpha chain)

SCOPe Domain Sequences for d2pghc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pghc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Pig (Sus scrofa) [TaxId: 9823]}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d2pghc_:

Click to download the PDB-style file with coordinates for d2pghc_.
(The format of our PDB-style files is described here.)

Timeline for d2pghc_: