SCOP 1.67: Domain d1hdac_: 1hda C:

Lineage for d1hdac_ (1hda C:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (20 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (17 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46490] (5 PDB entries)

8. Domain d1hdac_: 1hda C: [15387]
   Other proteins in same PDB: d1hdab_, d1hdad_
   complexed with hem

Details for d1hdac_

PDB Entry: 1hda, 2.2 Å

PDB Description: a novel allosteric mechanism in haemoglobin. structure of bovine deoxyhaemoglobin, absence of specific chloride-binding sites and origin of the chloride-linked bohr effect in bovine and human haemoglobin

SCOP Domain Sequences for d1hdac_:

Sequence; same for both SEQRES and ATOM records:

>d1hdac_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus)}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

Timeline for d1hdac_:

• d1hdac_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdac_ appears in SCOP 1.65
  
• d1hdac_ appears in SCOP 1.69
  
• d1hdac_ appears in the current release, SCOPe 2.08