Lineage for d1hdac_ (1hda C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 94Protein Hemoglobin, alpha-chain [46486] (13 species)
  7. 112Species Cow (Bos taurus) [TaxId:9913] [46490] (4 PDB entries)
  8. 120Domain d1hdac_: 1hda C: [15387]
    Other proteins in same PDB: d1hdab_, d1hdad_

Details for d1hdac_

PDB Entry: 1hda (more details), 2.2 Å

PDB Description: a novel allosteric mechanism in haemoglobin. structure of bovine deoxyhaemoglobin, absence of specific chloride-binding sites and origin of the chloride-linked bohr effect in bovine and human haemoglobin

SCOP Domain Sequences for d1hdac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdac_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus)}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d1hdac_:

Click to download the PDB-style file with coordinates for d1hdac_.
(The format of our PDB-style files is described here.)

Timeline for d1hdac_: