Lineage for d2yzbf1 (2yzb F:11-141)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868802Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 868803Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 869038Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)
  6. 869039Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. 869040Species Arthrobacter globiformis [TaxId:1665] [143630] (6 PDB entries)
  8. 869067Domain d2yzbf1: 2yzb F:11-141 [153848]
    automatically matched to d1vaxa2
    complexed with urc

Details for d2yzbf1

PDB Entry: 2yzb (more details), 1.9 Å

PDB Description: Crystal structure of uricase from Arthrobacter globiformis in complex with uric acid (substrate)
PDB Compounds: (F:) Uricase

SCOP Domain Sequences for d2yzbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzbf1 d.96.1.4 (F:11-141) Urate oxidase (uricase) {Arthrobacter globiformis [TaxId: 1665]}
tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
evrtavleisg

SCOP Domain Coordinates for d2yzbf1:

Click to download the PDB-style file with coordinates for d2yzbf1.
(The format of our PDB-style files is described here.)

Timeline for d2yzbf1: