SCOP 1.75: Domain d2yzba1: 2yzb A:11-141

Lineage for d2yzba1 (2yzb A:11-141)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (1 protein)

6. Protein Urate oxidase (uricase) [55634] (3 species)
   duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16

7. Species Arthrobacter globiformis [TaxId:1665] [143630] (6 PDB entries)

8. Domain d2yzba1: 2yzb A:11-141 [153838]
   automatically matched to d1vaxa2
   complexed with urc

Details for d2yzba1

PDB Entry: 2yzb, 1.9 Å

PDB Description: Crystal structure of uricase from Arthrobacter globiformis in complex with uric acid (substrate)

PDB Compounds: (A:) Uricase

SCOP Domain Sequences for d2yzba1:

Sequence; same for both SEQRES and ATOM records:

>d2yzba1 d.96.1.4 (A:11-141) Urate oxidase (uricase) {Arthrobacter globiformis [TaxId: 1665]}
tkvvlgqnqygkaevrlvkvtrntarheiqdlnvtsqlrgdfeaahtagdnahvvatdtq
kntvyafardgfatteefllrlgkhftegfdwvtggrwaaqqffwdrindhdhafsrnks
evrtavleisg

Timeline for d2yzba1:

• d2yzba1 is new in SCOP 1.75
  
• d2yzba1 appears in SCOPe 2.01
  
• d2yzba1 appears in the current release, SCOPe 2.08