SCOPe 2.06: Domain d2yz3b_: 2yz3 B:

Lineage for d2yz3b_ (2yz3 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (12 species)

7. Species Pseudomonas putida [TaxId:303] [160850] (1 PDB entry)

8. Domain d2yz3b_: 2yz3 B: [153836]
   automated match to d4fr7a_
   complexed with m5p, so4, zn

Details for d2yz3b_

PDB Entry: 2yz3, 2.3 Å

PDB Description: Crystallographic Investigation of Inhibition Mode of the VIM-2 Metallo-beta-lactamase from Pseudomonas aeruginosa with Mercaptocarboxylate Inhibitor

PDB Compounds: (B:) metallo-beta-lactamase

SCOPe Domain Sequences for d2yz3b_:

Sequence; same for both SEQRES and ATOM records:

>d2yz3b_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas putida [TaxId: 303]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvv

Timeline for d2yz3b_:

• d2yz3b_ first appeared in SCOP 1.75, called d2yz3b1
  
• d2yz3b_ appears in SCOPe 2.05
  
• d2yz3b_ appears in SCOPe 2.07
  
• d2yz3b_ appears in the current release, SCOPe 2.08