Lineage for d2yz3b_ (2yz3 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996784Species Pseudomonas putida [TaxId:303] [160850] (1 PDB entry)
  8. 2996786Domain d2yz3b_: 2yz3 B: [153836]
    automated match to d4fr7a_
    complexed with m5p, so4, zn

Details for d2yz3b_

PDB Entry: 2yz3 (more details), 2.3 Å

PDB Description: Crystallographic Investigation of Inhibition Mode of the VIM-2 Metallo-beta-lactamase from Pseudomonas aeruginosa with Mercaptocarboxylate Inhibitor
PDB Compounds: (B:) metallo-beta-lactamase

SCOPe Domain Sequences for d2yz3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yz3b_ d.157.1.1 (B:) Zn metallo-beta-lactamase {Pseudomonas putida [TaxId: 303]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvv

SCOPe Domain Coordinates for d2yz3b_:

Click to download the PDB-style file with coordinates for d2yz3b_.
(The format of our PDB-style files is described here.)

Timeline for d2yz3b_: