Lineage for d2yz3a1 (2yz3 A:12-236)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876592Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 876593Protein Zn metallo-beta-lactamase [56283] (10 species)
  7. 876658Species Pseudomonas putida [TaxId:303] [160850] (1 PDB entry)
  8. 876659Domain d2yz3a1: 2yz3 A:12-236 [153835]
    automatically matched to d1ko2a_
    complexed with m5p, so4, zn

Details for d2yz3a1

PDB Entry: 2yz3 (more details), 2.3 Å

PDB Description: Crystallographic Investigation of Inhibition Mode of the VIM-2 Metallo-beta-lactamase from Pseudomonas aeruginosa with Mercaptocarboxylate Inhibitor
PDB Compounds: (A:) metallo-beta-lactamase

SCOP Domain Sequences for d2yz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yz3a1 d.157.1.1 (A:12-236) Zn metallo-beta-lactamase {Pseudomonas putida [TaxId: 303]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvv

SCOP Domain Coordinates for d2yz3a1:

Click to download the PDB-style file with coordinates for d2yz3a1.
(The format of our PDB-style files is described here.)

Timeline for d2yz3a1: