![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
![]() | Protein Zn metallo-beta-lactamase [56283] (14 species) |
![]() | Species Pseudomonas putida [TaxId:303] [160850] (1 PDB entry) |
![]() | Domain d2yz3a_: 2yz3 A: [153835] automated match to d4fr7a_ complexed with m5p, so4, zn |
PDB Entry: 2yz3 (more details), 2.3 Å
SCOPe Domain Sequences for d2yz3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yz3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas putida [TaxId: 303]} eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvv
Timeline for d2yz3a_: