SCOPe 2.08: Domain d2yyeb2: 2yye B:155-336

Lineage for d2yyeb2 (2yye B:155-336)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)

6. Protein Selenide, water dikinase SelD [160785] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [160786] (4 PDB entries)
   Uniprot O67139 155-336

8. Domain d2yyeb2: 2yye B:155-336 [153834]
   Other proteins in same PDB: d2yyea1, d2yyea3, d2yyeb1, d2yyeb3
   automated match to d2yyea2
   complexed with apc, co, po4

Details for d2yyeb2

PDB Entry: 2yye, 2.1 Å

PDB Description: Crystal structure of selenophosphate synthetase from Aquifex aeolicus complexed with AMPCPP

PDB Compounds: (B:) Selenide, water dikinase

SCOPe Domain Sequences for d2yyeb2:

Sequence; same for both SEQRES and ATOM records:

>d2yyeb2 d.139.1.1 (B:155-336) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
itqsgaqvgqlliltkpigtgilikglkegilkeedineaienmlalndkarnlmlslda
tactdvtgfgllghawnicknsnigariffekvpyyqlsenlvkkkiypkgaienlnfvk
nylksnldnwklillsdpvtsggllftinkeklekidetakelevnywiigetiaenvle
vl

Timeline for d2yyeb2:

• d2yyeb2 first appeared in SCOP 1.75
  
• d2yyeb2 appears in SCOPe 2.07