SCOP 1.75: Domain d2yy2a1: 2yy2 A:181-506

Lineage for d2yy2a1 (2yy2 A:181-506)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (7 PDB entries)
   Uniprot O76083 241-566

8. Domain d2yy2a1: 2yy2 A:181-506 [153829]
   automatically matched to d2hd1a1
   complexed with ibm, mg, zn

Details for d2yy2a1

PDB Entry: 2yy2, 2.8 Å

PDB Description: Crystal structure of the human Phosphodiesterase 9A catalytic domain complexed with IBMX

PDB Compounds: (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOP Domain Sequences for d2yy2a1:

Sequence; same for both SEQRES and ATOM records:

>d2yy2a1 a.211.1.2 (A:181-506) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk

Timeline for d2yy2a1:

• d2yy2a1 is new in SCOP 1.75
  
• d2yy2a1 is called d2yy2a_ in SCOPe 2.01
  
• d2yy2a1 appears in the current release, SCOPe 2.08, called d2yy2a_