Lineage for d2yy2a_ (2yy2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2737088Protein automated matches [190370] (2 species)
    not a true protein
  7. 2737094Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)
  8. 2737120Domain d2yy2a_: 2yy2 A: [153829]
    automated match to d2hd1a1
    complexed with ibm, mg, zn

Details for d2yy2a_

PDB Entry: 2yy2 (more details), 2.8 Å

PDB Description: Crystal structure of the human Phosphodiesterase 9A catalytic domain complexed with IBMX
PDB Compounds: (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d2yy2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yy2a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk

SCOPe Domain Coordinates for d2yy2a_:

Click to download the PDB-style file with coordinates for d2yy2a_.
(The format of our PDB-style files is described here.)

Timeline for d2yy2a_: