SCOPe 2.08: Domain d2yy2a_: 2yy2 A:

Lineage for d2yy2a_ (2yy2 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein automated matches [190370] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)

8. Domain d2yy2a_: 2yy2 A: [153829]
   automated match to d2hd1a1
   complexed with ibm, mg, zn

Details for d2yy2a_

PDB Entry: 2yy2, 2.8 Å

PDB Description: Crystal structure of the human Phosphodiesterase 9A catalytic domain complexed with IBMX

PDB Compounds: (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d2yy2a_:

Sequence; same for both SEQRES and ATOM records:

>d2yy2a_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk

Timeline for d2yy2a_:

• d2yy2a_ first appeared in SCOP 1.75, called d2yy2a1
  
• d2yy2a_ appears in SCOPe 2.07