Lineage for d2yxrc1 (2yxr C:21-52)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629710Superfamily f.17.6: Sec-beta or SecG subunit of protein translocation channel [267595] (2 families) (S)
  5. 2629711Family f.17.6.1: Sec-beta subunit [267608] (1 protein)
  6. 2629712Protein Sec-beta subunit [267634] (2 species)
  7. 2629715Species Methanococcus jannaschii [TaxId:2190] [267695] (4 PDB entries)
  8. 2629719Domain d2yxrc1: 2yxr C:21-52 [153828]
    Other proteins in same PDB: d2yxrb1
    automatically matched to d1rh5c_

Details for d2yxrc1

PDB Entry: 2yxr (more details), 3.6 Å

PDB Description: The plug domain of the SecY protein stablizes the closed state of the translocation channel and maintains a membrane seal
PDB Compounds: (C:) Preprotein translocase secG subunit

SCOPe Domain Sequences for d2yxrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yxrc1 f.17.6.1 (C:21-52) Sec-beta subunit {Methanococcus jannaschii [TaxId: 2190]}
etfskirvkpehvigvtvafviieailtygrf

SCOPe Domain Coordinates for d2yxrc1:

Click to download the PDB-style file with coordinates for d2yxrc1.
(The format of our PDB-style files is described here.)

Timeline for d2yxrc1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yxrb1