SCOPe 2.07: Domain d2yxrc1: 2yxr C:21-52

Lineage for d2yxrc1 (2yxr C:21-52)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.6: Sec-beta or SecG subunit of protein translocation channel [267595] (2 families)

5. Family f.17.6.1: Sec-beta subunit [267608] (1 protein)

6. Protein Sec-beta subunit [267634] (2 species)

7. Species Methanococcus jannaschii [TaxId:2190] [267695] (4 PDB entries)

8. Domain d2yxrc1: 2yxr C:21-52 [153828]
   Other proteins in same PDB: d2yxrb1
   automatically matched to d1rh5c_

Details for d2yxrc1

PDB Entry: 2yxr, 3.6 Å

PDB Description: The plug domain of the SecY protein stablizes the closed state of the translocation channel and maintains a membrane seal

PDB Compounds: (C:) Preprotein translocase secG subunit

SCOPe Domain Sequences for d2yxrc1:

Sequence; same for both SEQRES and ATOM records:

>d2yxrc1 f.17.6.1 (C:21-52) Sec-beta subunit {Methanococcus jannaschii [TaxId: 2190]}
etfskirvkpehvigvtvafviieailtygrf

Timeline for d2yxrc1:

• d2yxrc1 first appeared in SCOP 1.75
  
• d2yxrc1 appears in SCOPe 2.06
  
• d2yxrc1 appears in the current release, SCOPe 2.08