Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.6: Sec-beta or SecG subunit of protein translocation channel [267595] (2 families) |
Family f.17.6.1: Sec-beta subunit [267608] (1 protein) |
Protein Sec-beta subunit [267634] (2 species) |
Species Methanococcus jannaschii [TaxId:2190] [267695] (4 PDB entries) |
Domain d2yxrc1: 2yxr C:21-52 [153828] Other proteins in same PDB: d2yxrb1 automatically matched to d1rh5c_ |
PDB Entry: 2yxr (more details), 3.6 Å
SCOPe Domain Sequences for d2yxrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yxrc1 f.17.6.1 (C:21-52) Sec-beta subunit {Methanococcus jannaschii [TaxId: 2190]} etfskirvkpehvigvtvafviieailtygrf
Timeline for d2yxrc1: