Lineage for d2yxrb1 (2yxr B:2-66)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698615Superfamily f.23.28: Preprotein translocase SecE subunit [103456] (1 family) (S)
  5. 1698616Family f.23.28.1: Preprotein translocase SecE subunit [103457] (1 protein)
  6. 1698617Protein Preprotein translocase SecE subunit [103458] (2 species)
  7. 1698620Species Methanococcus jannaschii [TaxId:2190] [103459] (4 PDB entries)
  8. 1698624Domain d2yxrb1: 2yxr B:2-66 [153827]
    Other proteins in same PDB: d2yxrc1
    automatically matched to d1rhzb_

Details for d2yxrb1

PDB Entry: 2yxr (more details), 3.6 Å

PDB Description: The plug domain of the SecY protein stablizes the closed state of the translocation channel and maintains a membrane seal
PDB Compounds: (B:) Preprotein translocase subunit secE

SCOPe Domain Sequences for d2yxrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yxrb1 f.23.28.1 (B:2-66) Preprotein translocase SecE subunit {Methanococcus jannaschii [TaxId: 2190]}
tdfnqkieqlkefieecrrvwlvlkkptkdeylavakvtalgisllgiigyiihvpatyi
kgilk

SCOPe Domain Coordinates for d2yxrb1:

Click to download the PDB-style file with coordinates for d2yxrb1.
(The format of our PDB-style files is described here.)

Timeline for d2yxrb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yxrc1