Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.29: Sec-beta subunit [103460] (1 family) |
Family f.23.29.1: Sec-beta subunit [103461] (1 protein) |
Protein Sec-beta subunit [103462] (2 species) |
Species Archaeon Methanococcus jannaschii [TaxId:2190] [103463] (4 PDB entries) |
Domain d2yxqc1: 2yxq C:21-52 [153826] Other proteins in same PDB: d2yxqb1 automatically matched to d1rh5c_ |
PDB Entry: 2yxq (more details), 3.5 Å
SCOP Domain Sequences for d2yxqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yxqc1 f.23.29.1 (C:21-52) Sec-beta subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} etfskirvkpehvigvtvafviieailtygrf
Timeline for d2yxqc1: